Skip to main content

Advertisement

Table 1 Amino acid sequences and glycosyl hydrolase families for all six bacterial enzymes.

From: Hemicellulases and auxiliary enzymes for improved conversion of lignocellulosic biomass to monosaccharides

Notation Amino acid sequence GH family Uniprot No. Source, name and predicted molecular weight
LX3 MSGNALRDYAEARGIKIGTCVNYPFYNNSDPTYNSILQREFSMVVCENEMKFDALQPRQNVFDFSKGDQLLAFAERNGMQMRGHTLIWHNQNPSWLTNGNWNRDSLLAVMKNHITTVMTHYKGKIVEWDVANECMDDSGNGLRSSIWRNVIGQDYLDYAFRYAREADPDALLFYNDYNIEDLGPKSNAVFNMIKSMKERGVPIDGVGFQCHFINGMSPEYLASIDQNIKRYAEIGVIVSFTEIDIRIPQSENPATAFQVQANNYKELMKICLANPNCNTFVMWGFTDKYTWIPGTFPGYGNPLIYDSNYNPKPAYNAIKEALMGYHHHHHH 10 P10478 Truncated Clostridium thermocellum
(XynZ, 38.0 kDa)
(corresponds to last 324 A.A. in protein of the mature enzyme)
LX4 MKMGKMYEVALVVEGYQSSGKADVTSMTITVGNAPSTSSPPGPTPEPTPRSAFSKIEAEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSNGVNPTPTSQPQQGQVLGDLNGDKQVNSTDYTALKRHLLNITRLSGTALANADLNGDGKVDSTDLMILHRYLLGIISSFPRSNPQPSSNPQPSSNPQPTINPNAKLVALTFDDGPDNVLTARVLDKLDKYNVKATFMVVGQRVNDSTAAIIRRMVNSGHEIGNHSWSYSGMANMSPDQIRKSIADTNAVIQKYAGTTPKFFRPPNLETSPTLFNNVDLVFVGGLTANDWIPSTTAEQRAAAVINGVRDGTIILLHDVQPEPHPTPEALDIIIPTLKSRGYEFVTLTELFTLKGVPIDPSVKRMYNSVP 11 O87119 Truncated C. thermocellum
(XynA, 52.1 kDa)
(corresponds to residues 199-683 of the mature enzyme)
LX5 KNKRVLAKITALVVLLGVFFVLPSNISQLYADYEVVHDTFEVNFDGWCNLGVDTYLTAVENEGNNGTRGMMVINRSSASDGAYSEKGFYLDGGVEYKYSVFVKHNGTGTETFKLSVSYLDSETEEENKEVIATKDVVAGEWTEISAKYKAPKTAVNITLSITTDSTVDFIFDDVTITRKGMAEANTVYAANAVLKDMYANYFRVGSVLNSGTVNNSSIKALILREFNSITCENEMKPDATLVQSGSTNTNIRVSLNRAASILNFCAQNNIAVRGHTLVWHSQTPQWFFKDNFQDNGNWVSQSVMDQRLESYIKNMFAEIQRQYPSLNLYAYDVVNEAVSDDANRTRYYGGAREPGYGNGRSPWVQIYGDNKFIEKAFTYARKYAPANCKL
YYNDYNEYWDHKRDCIASICANLYNKGLLDGVGMQSHINADMNGFSGIQNYKAALQKYINIGCDVQITELDISTENGKFSLQQQADKYKAVFQAAVDINRTSSKGKVTAVCVWGPNDANTWLGSQNAPLLFNANNQPKPAYNAVASIIPQSEWGDGNNPAGGGGGGKPEEPDANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGSESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQRYDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVIEGPAPQPTQPPVLLGDVNG
10 B4BME8 Truncated C. thermocellum
(XynY, 81.4 kDa)
(corresponds to residues 1-736 of mature enzyme)
LX6 MEIPSLKEVYKDYFPIGAAVSHLNIYTYEDLLKKHFNSLTPENQMKWEVIHPKPYVYDFGPADEIVDFAMKNGMKVRGHTLVWHNQTPGWVYAGTKDEILARLKEHIYEVVGHYKGKVYAWDVVNEALSDNPNEFLRKAPWYDICGEEVIEKAFIWANEADPNAKLFYNDYNLEDPIKREKAYQLVKRLKEKGIPIHGVGIQGHWTLAWPTPKMLEDSIKRFSELGVEVQITEFDISIYYDRNENNNFKVPPDDRIEKQAQLYKQAFEILRKYRGVVTGVTFWGVADDYTWLYFWPVRGREDYPLLFDKNHNPKKAFWEIVKFHHHHHH 10 B8E346 Dictyoglomus turgidum
(Dtur_1647, 38.1 kDa)
LαGl MAEVKPYNMCWLEYTDLSKYKNKYIKVFENVVVLGGNELNLPLKELKNFLTFSLNIKPKIFKNTLVKGRNYVLIGRLIEIKKIFKESERFEKLLNDEGFIIKRIDIDGNKVLIITAKSYNGIVYGIFNLIERLKRGEDIENIDIVSNPSLRFRMLNHWDNLDGSIERGYAGKSIFFRENKILINERTKDYARLLSSIGVNGVVINNVNVKKKEVELITPSYLKKIGELSKIFSAYGIKIY
LSINFASPIYLGGLNTADPLDKRVAVWWKAKVDEIYEYVPDFGGFLVKADSEFNPGPHMYGRTHADGANMLGEALESYGGFVIWRAFVYNCLQDWRDTNTDRAKAAYENFKPLDGKFSENVIVQIKYGPMDFQVREPVNPLFGGLEHTNQILELQITQEYTGQQIHLCYLGTLWKEVLDFDTYAKGEGSKVKEILKGNVFDLKNNGMAGVSNVGDDINWTGHDLAQANLYTFGALSWNPDERIEEVVKRWIELTFGDNEKVIKNISYMLLSSHKAYEKYTTPLGLGWMVNPGHHYGPNPEGYEYSKWGTYHRANYEAIGVDRSSRGTGYTLQYHSPWREIYDNIETCPEELLLFFHRVPYNYKLKSGKTLIQTYYDLHFEGVEEAEEIRKKWIELKGEIEDKIYERVLNRLDIQIEHAKEWRDVINTYFFRRTGIPDEKGRKIYPHHHHHH
67 B8E3B2 D. turgidum
(Dtur_1714, 79.4 kDa)
LArb MSVKRAQMIIEKDFKIAKIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIEMVKELQVPIIRYPGGNFVSGYNWEDGVGPKEKRPRRLDLAWKSVETNEIGLNEFVDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRISHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVACGSSGRNMPTFAEWEAIVLDHTYEHVDYISLHQYFGNRDNDTANYLAMSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKQIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIM
TEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDSLLLECDVRNFEDYRVIEHIVLEHENVKQTNSAQSSPVVPHRNGNAQM
51 B4BMB8 Geobacillus sp. G11MC16
(57.1 kDa)